PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr034885.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 226aa    MW: 25920.1 Da    PI: 7.302
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr034885.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-17956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l+d+++ +G g+W++I++  g++R++k+c++rw+++l
      Pbr034885.1  9 KGLWTKEEDEILLDYIRVHGRGRWNRIPKVTGLRRSGKSCRLRWLNHL 56
                     678*******************************************97 PP

2Myb_DNA-binding57.72.6e-1862107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE++l+++++++lG++ W++Ia +++ gRt++q+k++w+++l
      Pbr034885.1  62 RGDFSEEEEDLIIRLHNLLGNR-WSLIAGRVP-GRTDNQVKNYWNTHL 107
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.966156IPR017930Myb domain
SuperFamilySSF466893.82E-307103IPR009057Homeodomain-like
SMARTSM007172.3E-15858IPR001005SANT/Myb domain
PfamPF002491.6E-15956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-231063IPR009057Homeodomain-like
CDDcd001676.45E-121256No hitNo description
PROSITE profilePS5129426.22557111IPR017930Myb domain
SMARTSM007176.5E-1761109IPR001005SANT/Myb domain
PfamPF002492.3E-1762107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2564111IPR009057Homeodomain-like
CDDcd001675.09E-1265107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010053Biological Processroot epidermal cell differentiation
GO:0010091Biological Processtrichome branching
GO:0048629Biological Processtrichome patterning
GO:0090377Biological Processseed trichome initiation
GO:0090378Biological Processseed trichome elongation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEGEYKYKKG LWTKEEDEIL LDYIRVHGRG RWNRIPKVTG LRRSGKSCRL RWLNHLSPNV  60
KRGDFSEEEE DLIIRLHNLL GNRWSLIAGR VPGRTDNQVK NYWNTHLYKK LNAIKKQQTP  120
RNVAVVSTSK TTTHSSSAAQ ELAGDKLVHQ HKLLEAPDSD SNSVTKSNDQ NPNMDIVAAE  180
DSNAEEEEIE WMAKHCTELL SCSSYGNMIS WDMVEFQQGY HLDLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-27911127128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00538DAPTransfer from AT5G40330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363558.11e-169PREDICTED: transcription factor WER-like
SwissprotQ962765e-64MYB23_ARATH; Transcription factor MYB23
TrEMBLM5XZK01e-91M5XZK0_PRUPE; Uncharacterized protein
STRINGVIT_01s0127g00730.t011e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.12e-63myb domain protein 66